PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.B03006.1.p
Common NameEUGRSUZ_B03006, LOC104433270
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 306aa    MW: 34356.3 Da    PI: 6.4002
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.B03006.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding506.9e-162269148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg+WT eEd ll++ ++ +G g+W+  a+  g++Rt+k+c++rw++yl
  Eucgr.B03006.1.p 22 RGPWTREEDNLLIHSITCHGEGRWNMLAKSAGLKRTGKSCRLRWLNYL 69
                      89********************************************97 PP

2Myb_DNA-binding51.52.3e-1675118146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg+ T++E++ ++++++++G++ W++Ia++++ gRt++++k++w++
  Eucgr.B03006.1.p  75 RGNLTPQEQLMILELHHKWGNR-WSKIAQYLP-GRTDNEIKNYWRT 118
                       7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.8691769IPR017930Myb domain
SuperFamilySSF466893.74E-3020116IPR009057Homeodomain-like
SMARTSM007171.1E-122171IPR001005SANT/Myb domain
PfamPF002491.3E-132269IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-222376IPR009057Homeodomain-like
CDDcd001676.96E-112469No hitNo description
PROSITE profilePS5129424.82770124IPR017930Myb domain
SMARTSM007175.7E-1574122IPR001005SANT/Myb domain
PfamPF002491.2E-1575118IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-2377123IPR009057Homeodomain-like
CDDcd001673.30E-1279118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009686Biological Processgibberellin biosynthetic process
GO:0009751Biological Processresponse to salicylic acid
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MPGFTRARKM SMSGEEEGDL RRGPWTREED NLLIHSITCH GEGRWNMLAK SAGLKRTGKS  60
CRLRWLNYLR PDIKRGNLTP QEQLMILELH HKWGNRWSKI AQYLPGRTDN EIKNYWRTRV  120
QKQARQLNIE SDSERFLDAV RHIWMPRLLQ KMEQASSSDQ TTRTSDMSMN CSVSASPVHY  180
PPSTSSPSKL TQNSNSSMEV SSYTMADADI SPNFPITGQT PEIPEAFSNA DVVGFGNSTA  240
YNPLLAGDGY FGDGTSYDVN DYATMSALSA CNGFPLQGHV EGGNWAVDDV ADACWTVDDI  300
WKFRD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-26191244108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00216DAPTransfer from AT1G68320Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.B03006.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010044254.10.0PREDICTED: transcription factor MYB24-like
TrEMBLA0A059D7B90.0A0A059D7B9_EUCGR; Uncharacterized protein
STRINGPOPTR_0008s12130.11e-105(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26322571
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.12e-88myb domain protein 62